PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010106176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HSF
Protein Properties Length: 95aa    MW: 10739 Da    PI: 9.0646
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010106176.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind86.92.7e-272085267
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE--- CS
    HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkd 67
                    Fl+k+y++++d+++++++sws+++nsfvv++   fa+++Lpk+Fkh+nf+SFvRQLn+Yg k++++
  XP_010106176.1 20 FLSKTYDMVDDPSTDSIVSWSDHNNSFVVWNAPLFARDLLPKFFKHNNFSSFVRQLNTYGRKELSK 85
                    9***********************************************************887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.107.3E-301084IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.4E-261688IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467857.21E-261882IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004474.4E-232083IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.1E-192043IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.1E-195870IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.1E-197183IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MEVGRDAAST TNSGPSPPPF LSKTYDMVDD PSTDSIVSWS DHNNSFVVWN APLFARDLLP  60
KFFKHNNFSS FVRQLNTYGR KELSKALRLA SQLSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5v_D6e-211831492Heat shock factor protein 1
5d5v_B6e-211831492Heat shock factor protein 1
5d5u_B6e-211831492Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106176.16e-65hypothetical protein L484_009600
SwissprotP411511e-33HFA1A_ARATH; Heat stress transcription factor A-1a
TrEMBLW9S4627e-65W9S462_9R
STRINGPOPTR_0003s09370.15e-33(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.17e-35heat shock factor 1